LL-37 amide trifluoroacetate salt,CAS: 597562-32-8
LL-37 amide trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-907 | 1mg | 355.00 | + Add to cart |
|
R-M-907 | 5mg | 1070.00 | + Add to cart |
|
|
Product description
LL-37 amide is an antimicrobial peptide with angiogenic activity.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 597562-32-8 |
Sequence | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH₂ |
Synonyms | Antibacterial Protein LL-37 amide (human), LL37, CAMP |
Molecular Formula | C₂₀₅H₃₄₁N₆₁O₅₂ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product